PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G190300.1
Common NamePHAVU_003G190300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 79aa    MW: 8309.43 Da    PI: 9.0555
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G190300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.51.2e-312073357
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                        ++rY eC+kNhAa++Gg+avDGC+Efm+s   egt+aal+CaACgCHRnFH++ev
  Phvul.003G190300.1 20 NIRYGECQKNHAANTGGYAVDGCREFMAS-AGEGTSAALTCAACGCHRNFHKKEV 73
                        689*************************9.6668*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-22173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-292173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-252273IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.0812372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MKKRQVVVKR DYATSSAVGN IRYGECQKNH AANTGGYAVD GCREFMASAG EGTSAALTCA  60
ACGCHRNFHK KEVLLGVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-91AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155312.17e-52hypothetical protein PHAVU_003G190300g
SwissprotQ9LJW54e-30MIF2_ARATH; Mini zinc finger protein 2
TrEMBLV7CEI28e-52V7CEI2_PHAVU; Uncharacterized protein
STRINGGLYMA05G01060.13e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-31mini zinc finger 2